Protein Description: otopetrin 2
Gene Name: OTOP2
Alternative Gene Name:
Sequence: DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ
Interspecies mouse/rat: ENSMUSG00000050201: 64%, ENSRNOG00000028121: 60%
Entrez Gene ID: 92736
Uniprot ID: Q7RTS6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: OTOP2
Alternative Gene Name:
Sequence: DESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQ
Interspecies mouse/rat: ENSMUSG00000050201: 64%, ENSRNOG00000028121: 60%
Entrez Gene ID: 92736
Uniprot ID: Q7RTS6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen OTOP2 (ATL-APrEST75934) | |
| Antibody | Anti OTOP2 pAb (ATL-HPA053090) |
| Documents & Links for PrEST Antigen OTOP2 (ATL-APrEST75934) | |
| Datasheet | PrEST Antigen OTOP2 (ATL-APrEST75934) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OTOP2 (ATL-APrEST75934) at Atlas |
| Documents & Links for PrEST Antigen OTOP2 (ATL-APrEST75934) | |
| Datasheet | PrEST Antigen OTOP2 (ATL-APrEST75934) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OTOP2 (ATL-APrEST75934) |