Protein Description: oncomodulin
Gene Name: OCM
Alternative Gene Name: OCM1
Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
Interspecies mouse/rat: ENSMUSG00000029618: 95%, ENSRNOG00000001031: 93%
Entrez Gene ID: 654231
Uniprot ID: P0CE72
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: OCM
Alternative Gene Name: OCM1
Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
Interspecies mouse/rat: ENSMUSG00000029618: 95%, ENSRNOG00000001031: 93%
Entrez Gene ID: 654231
Uniprot ID: P0CE72
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen OCM (ATL-APrEST82915) | |
| Antibody | Anti OCM pAb (ATL-HPA046422) |
| Documents & Links for PrEST Antigen OCM (ATL-APrEST82915) | |
| Datasheet | PrEST Antigen OCM (ATL-APrEST82915) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OCM (ATL-APrEST82915) at Atlas |
| Documents & Links for PrEST Antigen OCM (ATL-APrEST82915) | |
| Datasheet | PrEST Antigen OCM (ATL-APrEST82915) Datasheet (External Link) |
| Vendor Page | PrEST Antigen OCM (ATL-APrEST82915) |