Protein Description: nicotinamide nucleotide adenylyltransferase 3
Gene Name: NMNAT3
Alternative Gene Name: PNAT3
Sequence: VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV
Interspecies mouse/rat: ENSMUSG00000032456: 84%, ENSRNOG00000013585: 83%
Entrez Gene ID: 349565
Uniprot ID: Q96T66
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: NMNAT3
Alternative Gene Name: PNAT3
Sequence: VDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCV
Interspecies mouse/rat: ENSMUSG00000032456: 84%, ENSRNOG00000013585: 83%
Entrez Gene ID: 349565
Uniprot ID: Q96T66
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen NMNAT3 (ATL-APrEST79457) | |
| Antibody | Anti NMNAT3 pAb (ATL-HPA057402) |
| Documents & Links for PrEST Antigen NMNAT3 (ATL-APrEST79457) | |
| Datasheet | PrEST Antigen NMNAT3 (ATL-APrEST79457) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT3 (ATL-APrEST79457) at Atlas |
| Documents & Links for PrEST Antigen NMNAT3 (ATL-APrEST79457) | |
| Datasheet | PrEST Antigen NMNAT3 (ATL-APrEST79457) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT3 (ATL-APrEST79457) |