PrEST Antigen NCCRP1 (ATL-APrEST95637)

Catalog No:
ATL-APrEST95637-100
$345.00

Description

Product Description

PrEST Antigen NCCRP1, Gene description: NCCRP1, F-box associated domain containing, Alternative Gene Names: FBXO50, LOC342897, NCCRP-1, Antigen sequence: WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA
Gene ID - Mouse ENSMUSG00000047586
Gene ID - Rat ENSRNOG00000054506
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST95637)
Vendor Page PrEST Antigen NCCRP1 (ATL-APrEST95637) at Atlas Antibodies

Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST95637)
Vendor Page PrEST Antigen NCCRP1 (ATL-APrEST95637)

Product Description

PrEST Antigen NCCRP1, Gene description: NCCRP1, F-box associated domain containing, Alternative Gene Names: FBXO50, LOC342897, NCCRP-1, Antigen sequence: WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence WEELLDDEQPAITVMDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVA
Gene ID - Mouse ENSMUSG00000047586
Gene ID - Rat ENSRNOG00000054506
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST95637)
Vendor Page PrEST Antigen NCCRP1 (ATL-APrEST95637) at Atlas Antibodies

Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST95637)
Vendor Page PrEST Antigen NCCRP1 (ATL-APrEST95637)