Protein Description: non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Sequence: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: NCCRP1
Alternative Gene Name: FBXO50, LOC342897, NCCRP-1
Sequence: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
Interspecies mouse/rat: ENSMUSG00000047586: 77%, ENSRNOG00000054506: 78%
Entrez Gene ID: 342897
Uniprot ID: Q6ZVX7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen NCCRP1 (ATL-APrEST85998) | |
| Antibody | Anti NCCRP1 pAb (ATL-HPA052812) |
| Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST85998) | |
| Datasheet | PrEST Antigen NCCRP1 (ATL-APrEST85998) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCCRP1 (ATL-APrEST85998) at Atlas |
| Documents & Links for PrEST Antigen NCCRP1 (ATL-APrEST85998) | |
| Datasheet | PrEST Antigen NCCRP1 (ATL-APrEST85998) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NCCRP1 (ATL-APrEST85998) |