Protein Description: N-acetylglucosamine kinase
Gene Name: NAGK
Alternative Gene Name: GNK
Sequence: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
Interspecies mouse/rat: ENSMUSG00000034744: 87%, ENSRNOG00000013911: 88%
Entrez Gene ID: 55577
Uniprot ID: Q9UJ70
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: NAGK
Alternative Gene Name: GNK
Sequence: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
Interspecies mouse/rat: ENSMUSG00000034744: 87%, ENSRNOG00000013911: 88%
Entrez Gene ID: 55577
Uniprot ID: Q9UJ70
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen NAGK (ATL-APrEST87111) | |
| Antibody | Anti NAGK pAb (ATL-HPA035206 w/enhanced validation) |
| Documents & Links for PrEST Antigen NAGK (ATL-APrEST87111) | |
| Datasheet | PrEST Antigen NAGK (ATL-APrEST87111) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NAGK (ATL-APrEST87111) at Atlas |
| Documents & Links for PrEST Antigen NAGK (ATL-APrEST87111) | |
| Datasheet | PrEST Antigen NAGK (ATL-APrEST87111) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NAGK (ATL-APrEST87111) |