PrEST Antigen MOGAT1 (ATL-APrEST95719)

Catalog No:
ATL-APrEST95719-100
$345.00

Description

Product Description

PrEST Antigen MOGAT1, Gene description: monoacylglycerol O-acyltransferase 1, Alternative Gene Names: DGAT2L, DGAT2L1, MGAT1, Antigen sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
Gene ID - Mouse ENSMUSG00000012187
Gene ID - Rat ENSRNOG00000014692
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen MOGAT1 (ATL-APrEST95719)
Vendor Page PrEST Antigen MOGAT1 (ATL-APrEST95719) at Atlas Antibodies

Documents & Links for PrEST Antigen MOGAT1 (ATL-APrEST95719)
Vendor Page PrEST Antigen MOGAT1 (ATL-APrEST95719)

Product Description

PrEST Antigen MOGAT1, Gene description: monoacylglycerol O-acyltransferase 1, Alternative Gene Names: DGAT2L, DGAT2L1, MGAT1, Antigen sequence: GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNIS
Gene ID - Mouse ENSMUSG00000012187
Gene ID - Rat ENSRNOG00000014692
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen MOGAT1 (ATL-APrEST95719)
Vendor Page PrEST Antigen MOGAT1 (ATL-APrEST95719) at Atlas Antibodies

Documents & Links for PrEST Antigen MOGAT1 (ATL-APrEST95719)
Vendor Page PrEST Antigen MOGAT1 (ATL-APrEST95719)