Description
Product Description
Protein Description: MOB kinase activator 1A
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
Product Specifications | |
Gene Sequence | RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL |
Gene ID - Mouse | ENSMUSG00000006262 |
Gene ID - Rat | ENSRNOG00000059474 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
Documents & Links for PrEST Antigen MOB1A (ATL-APrEST90351) | |
Datasheet | PrEST Antigen MOB1A (ATL-APrEST90351) Datasheet (External Link) |
Vendor Page | PrEST Antigen MOB1A (ATL-APrEST90351) at Atlas Antibodies |
Documents & Links for PrEST Antigen MOB1A (ATL-APrEST90351) | |
Datasheet | PrEST Antigen MOB1A (ATL-APrEST90351) Datasheet (External Link) |
Vendor Page | PrEST Antigen MOB1A (ATL-APrEST90351) |