PrEST Antigen KAT5 (ATL-APrEST95751)

Catalog No:
ATL-APrEST95751-100
$345.00

Description

Product Description

PrEST Antigen KAT5, Gene description: lysine acetyltransferase 5, Alternative Gene Names: cPLA2, ESA1, HTATIP, HTATIP1, PLIP, TIP60, ZC2HC5, Antigen sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR
Gene ID - Mouse ENSMUSG00000024926
Gene ID - Rat ENSRNOG00000061012
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen KAT5 (ATL-APrEST95751)
Vendor Page PrEST Antigen KAT5 (ATL-APrEST95751) at Atlas Antibodies

Documents & Links for PrEST Antigen KAT5 (ATL-APrEST95751)
Vendor Page PrEST Antigen KAT5 (ATL-APrEST95751)

Product Description

PrEST Antigen KAT5, Gene description: lysine acetyltransferase 5, Alternative Gene Names: cPLA2, ESA1, HTATIP, HTATIP1, PLIP, TIP60, ZC2HC5, Antigen sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR
Gene ID - Mouse ENSMUSG00000024926
Gene ID - Rat ENSRNOG00000061012
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen KAT5 (ATL-APrEST95751)
Vendor Page PrEST Antigen KAT5 (ATL-APrEST95751) at Atlas Antibodies

Documents & Links for PrEST Antigen KAT5 (ATL-APrEST95751)
Vendor Page PrEST Antigen KAT5 (ATL-APrEST95751)