PrEST Antigen JMJD6, Gene description: jumonji domain containing 6, arginine demethylase and lysine hydroxylase, Alternative Gene Names: KIAA0585, PTDSR, PTDSR1, Antigen sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications |
| Gene Sequence |
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA |
| Gene ID - Mouse |
ENSMUSG00000056962 |
| Gene ID - Rat |
ENSMUSG00000056962 |
| Buffer |
PBS and 1M Urea, pH 7.4. |
