PrEST Antigen HLA-DOA (ATL-APrEST95717)

Catalog No:
ATL-APrEST95717-100
$345.00

Description

Product Description

PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Gene ID - Mouse ENSMUSG00000024334
Gene ID - Rat ENSRNOG00000026762
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen HLA-DOA (ATL-APrEST95717)
Vendor Page PrEST Antigen HLA-DOA (ATL-APrEST95717) at Atlas Antibodies

Documents & Links for PrEST Antigen HLA-DOA (ATL-APrEST95717)
Vendor Page PrEST Antigen HLA-DOA (ATL-APrEST95717)

Product Description

PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Gene ID - Mouse ENSMUSG00000024334
Gene ID - Rat ENSRNOG00000026762
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen HLA-DOA (ATL-APrEST95717)
Vendor Page PrEST Antigen HLA-DOA (ATL-APrEST95717) at Atlas Antibodies

Documents & Links for PrEST Antigen HLA-DOA (ATL-APrEST95717)
Vendor Page PrEST Antigen HLA-DOA (ATL-APrEST95717)