Protein Description: hexokinase domain containing 1
Gene Name: HKDC1
Alternative Gene Name: FLJ22761, FLJ37767
Sequence: VQAQRKQIDRVLALFQLTREQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEK
Interspecies mouse/rat: ENSMUSG00000020080: 84%, ENSRNOG00000006116: 46%
Entrez Gene ID: 80201
Uniprot ID: Q2TB90
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: HKDC1
Alternative Gene Name: FLJ22761, FLJ37767
Sequence: VQAQRKQIDRVLALFQLTREQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEK
Interspecies mouse/rat: ENSMUSG00000020080: 84%, ENSRNOG00000006116: 46%
Entrez Gene ID: 80201
Uniprot ID: Q2TB90
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen HKDC1 (ATL-APrEST92440) | |
| Antibody | Anti HKDC1 pAb (ATL-HPA064230) |
| Documents & Links for PrEST Antigen HKDC1 (ATL-APrEST92440) | |
| Datasheet | PrEST Antigen HKDC1 (ATL-APrEST92440) Datasheet (External Link) |
| Vendor Page | PrEST Antigen HKDC1 (ATL-APrEST92440) at Atlas |
| Documents & Links for PrEST Antigen HKDC1 (ATL-APrEST92440) | |
| Datasheet | PrEST Antigen HKDC1 (ATL-APrEST92440) Datasheet (External Link) |
| Vendor Page | PrEST Antigen HKDC1 (ATL-APrEST92440) |