Protein Description: golgi phosphoprotein 3 (coat-protein)
Gene Name: GOLPH3
Alternative Gene Name: GOPP1, GPP34, MIDAS
Sequence: HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Interspecies mouse/rat: ENSMUSG00000022200: 100%, ENSRNOG00000012186: 100%
Entrez Gene ID: 64083
Uniprot ID: Q9H4A6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GOLPH3
Alternative Gene Name: GOPP1, GPP34, MIDAS
Sequence: HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Interspecies mouse/rat: ENSMUSG00000022200: 100%, ENSRNOG00000012186: 100%
Entrez Gene ID: 64083
Uniprot ID: Q9H4A6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GOLPH3 (ATL-APrEST79953) | |
| Antibody | Anti GOLPH3 pAb (ATL-HPA044564) |
| Documents & Links for PrEST Antigen GOLPH3 (ATL-APrEST79953) | |
| Datasheet | PrEST Antigen GOLPH3 (ATL-APrEST79953) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GOLPH3 (ATL-APrEST79953) at Atlas |
| Documents & Links for PrEST Antigen GOLPH3 (ATL-APrEST79953) | |
| Datasheet | PrEST Antigen GOLPH3 (ATL-APrEST79953) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GOLPH3 (ATL-APrEST79953) |