Protein Description: GINS complex subunit 3 (Psf3 homolog)
Gene Name: GINS3
Alternative Gene Name: FLJ13912, PSF3
Sequence: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL
Interspecies mouse/rat: ENSMUSG00000031669: 96%, ENSRNOG00000011863: 96%
Entrez Gene ID: 64785
Uniprot ID: Q9BRX5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GINS3
Alternative Gene Name: FLJ13912, PSF3
Sequence: PLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLL
Interspecies mouse/rat: ENSMUSG00000031669: 96%, ENSRNOG00000011863: 96%
Entrez Gene ID: 64785
Uniprot ID: Q9BRX5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GINS3 (ATL-APrEST91134) | |
| Antibody | Anti GINS3 pAb (ATL-HPA048209) |
| Documents & Links for PrEST Antigen GINS3 (ATL-APrEST91134) | |
| Datasheet | PrEST Antigen GINS3 (ATL-APrEST91134) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GINS3 (ATL-APrEST91134) at Atlas |
| Documents & Links for PrEST Antigen GINS3 (ATL-APrEST91134) | |
| Datasheet | PrEST Antigen GINS3 (ATL-APrEST91134) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GINS3 (ATL-APrEST91134) |