Description
Product Description
PrEST Antigen FAM186A, Gene description: family with sequence similarity 186 member A, Alternative Gene Names: LOC121006, Antigen sequence: DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
| Product Specifications | |
| Gene Sequence | DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT |
| Gene ID - Mouse | ENSMUSG00000045350 |
| Gene ID - Rat | ENSRNOG00000049592 |
| Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
| Documents & Links for PrEST Antigen FAM186A (ATL-APrEST96004) | |
| Vendor Page | PrEST Antigen FAM186A (ATL-APrEST96004) at Atlas Antibodies |
| Documents & Links for PrEST Antigen FAM186A (ATL-APrEST96004) | |
| Vendor Page | PrEST Antigen FAM186A (ATL-APrEST96004) |