Protein Description: fatty acid desaturase 3
Gene Name: FADS3
Alternative Gene Name: CYB5RP, LLCDL3
Sequence: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
Interspecies mouse/rat: ENSMUSG00000024664: 92%, ENSRNOG00000020385: 90%
Entrez Gene ID: 3995
Uniprot ID: Q9Y5Q0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: FADS3
Alternative Gene Name: CYB5RP, LLCDL3
Sequence: PLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAED
Interspecies mouse/rat: ENSMUSG00000024664: 92%, ENSRNOG00000020385: 90%
Entrez Gene ID: 3995
Uniprot ID: Q9Y5Q0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen FADS3 (ATL-APrEST83862) | |
Antibody | Anti FADS3 pAb (ATL-HPA045224) |
Documents & Links for PrEST Antigen FADS3 (ATL-APrEST83862) | |
Datasheet | PrEST Antigen FADS3 (ATL-APrEST83862) Datasheet (External Link) |
Vendor Page | PrEST Antigen FADS3 (ATL-APrEST83862) at Atlas |
Documents & Links for PrEST Antigen FADS3 (ATL-APrEST83862) | |
Datasheet | PrEST Antigen FADS3 (ATL-APrEST83862) Datasheet (External Link) |
Vendor Page | PrEST Antigen FADS3 (ATL-APrEST83862) |