Protein Description: glutamate-rich 4
Gene Name: ERICH4
Alternative Gene Name: LOC100170765
Sequence: SSETMELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDS
Interspecies mouse/rat: ENSMUSG00000074261: 54%, ENSRNOG00000037798: 56%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ERICH4
Alternative Gene Name: LOC100170765
Sequence: SSETMELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDS
Interspecies mouse/rat: ENSMUSG00000074261: 54%, ENSRNOG00000037798: 56%
Entrez Gene ID: 100170765
Uniprot ID: A6NGS2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ERICH4 (ATL-APrEST82871) | |
| Antibody | Anti ERICH4 pAb (ATL-HPA048484) |
| Documents & Links for PrEST Antigen ERICH4 (ATL-APrEST82871) | |
| Datasheet | PrEST Antigen ERICH4 (ATL-APrEST82871) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ERICH4 (ATL-APrEST82871) at Atlas |
| Documents & Links for PrEST Antigen ERICH4 (ATL-APrEST82871) | |
| Datasheet | PrEST Antigen ERICH4 (ATL-APrEST82871) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ERICH4 (ATL-APrEST82871) |