Protein Description: epidermal growth factor receptor pathway substrate 15
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: EPS15
Alternative Gene Name: AF-1P, MLLT5
Sequence: DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL
Interspecies mouse/rat: ENSMUSG00000028552: 94%, ENSRNOG00000010299: 92%
Entrez Gene ID: 2060
Uniprot ID: P42566
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | DPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARL |
Gene ID - Mouse | ENSMUSG00000028552 |
Gene ID - Rat | ENSRNOG00000010299 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen EPS15 (ATL-APrEST94213) | |
Datasheet | PrEST Antigen EPS15 (ATL-APrEST94213) Datasheet (External Link) |
Vendor Page | PrEST Antigen EPS15 (ATL-APrEST94213) at Atlas |
Documents & Links for PrEST Antigen EPS15 (ATL-APrEST94213) | |
Datasheet | PrEST Antigen EPS15 (ATL-APrEST94213) Datasheet (External Link) |
Vendor Page | PrEST Antigen EPS15 (ATL-APrEST94213) |