Protein Description: epoxide hydrolase 1, microsomal (xenobiotic)
Gene Name: EPHX1
Alternative Gene Name: EPHX
Sequence: LPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTN
Interspecies mouse/rat: ENSMUSG00000038776: 94%, ENSRNOG00000003515: 93%
Entrez Gene ID: 2052
Uniprot ID: P07099
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: EPHX1
Alternative Gene Name: EPHX
Sequence: LPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTN
Interspecies mouse/rat: ENSMUSG00000038776: 94%, ENSRNOG00000003515: 93%
Entrez Gene ID: 2052
Uniprot ID: P07099
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen EPHX1 (ATL-APrEST87522) | |
| Antibody | Anti EPHX1 pAb (ATL-HPA048847 w/enhanced validation) |
| Documents & Links for PrEST Antigen EPHX1 (ATL-APrEST87522) | |
| Datasheet | PrEST Antigen EPHX1 (ATL-APrEST87522) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EPHX1 (ATL-APrEST87522) at Atlas |
| Documents & Links for PrEST Antigen EPHX1 (ATL-APrEST87522) | |
| Datasheet | PrEST Antigen EPHX1 (ATL-APrEST87522) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EPHX1 (ATL-APrEST87522) |