Protein Description: enolase-phosphatase 1
Gene Name: ENOPH1
Alternative Gene Name: E1, MASA
Sequence: DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Interspecies mouse/rat: ENSMUSG00000029326: 96%, ENSRNOG00000002262: 96%
Entrez Gene ID: 58478
Uniprot ID: Q9UHY7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ENOPH1
Alternative Gene Name: E1, MASA
Sequence: DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Interspecies mouse/rat: ENSMUSG00000029326: 96%, ENSRNOG00000002262: 96%
Entrez Gene ID: 58478
Uniprot ID: Q9UHY7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ENOPH1 (ATL-APrEST79774) | |
| Antibody | Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation) |
| Documents & Links for PrEST Antigen ENOPH1 (ATL-APrEST79774) | |
| Datasheet | PrEST Antigen ENOPH1 (ATL-APrEST79774) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ENOPH1 (ATL-APrEST79774) at Atlas |
| Documents & Links for PrEST Antigen ENOPH1 (ATL-APrEST79774) | |
| Datasheet | PrEST Antigen ENOPH1 (ATL-APrEST79774) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ENOPH1 (ATL-APrEST79774) |