PrEST Antigen DQX1 (ATL-APrEST96116)

Catalog No:
ATL-APrEST96116-100
$345.00

Description

Product Description

PrEST Antigen DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Antigen sequence: VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL
Gene ID - Mouse ENSMUSG00000009145
Gene ID - Rat ENSRNOG00000053486
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen DQX1 (ATL-APrEST96116)
Vendor Page PrEST Antigen DQX1 (ATL-APrEST96116) at Atlas Antibodies

Documents & Links for PrEST Antigen DQX1 (ATL-APrEST96116)
Vendor Page PrEST Antigen DQX1 (ATL-APrEST96116)

Product Description

PrEST Antigen DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Antigen sequence: VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL
Gene ID - Mouse ENSMUSG00000009145
Gene ID - Rat ENSRNOG00000053486
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen DQX1 (ATL-APrEST96116)
Vendor Page PrEST Antigen DQX1 (ATL-APrEST96116) at Atlas Antibodies

Documents & Links for PrEST Antigen DQX1 (ATL-APrEST96116)
Vendor Page PrEST Antigen DQX1 (ATL-APrEST96116)