Protein Description: dehydrogenase/reductase (SDR family) member 11
Gene Name: DHRS11
Alternative Gene Name: MGC4172, SDR24C1
Sequence: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
Interspecies mouse/rat: ENSMUSG00000034449: 97%, ENSRNOG00000027891: 97%
Entrez Gene ID: 79154
Uniprot ID: Q6UWP2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DHRS11
Alternative Gene Name: MGC4172, SDR24C1
Sequence: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
Interspecies mouse/rat: ENSMUSG00000034449: 97%, ENSRNOG00000027891: 97%
Entrez Gene ID: 79154
Uniprot ID: Q6UWP2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen DHRS11 (ATL-APrEST81853) | |
Antibody | Anti DHRS11 pAb (ATL-HPA053623 w/enhanced validation) |
Documents & Links for PrEST Antigen DHRS11 (ATL-APrEST81853) | |
Datasheet | PrEST Antigen DHRS11 (ATL-APrEST81853) Datasheet (External Link) |
Vendor Page | PrEST Antigen DHRS11 (ATL-APrEST81853) at Atlas |
Documents & Links for PrEST Antigen DHRS11 (ATL-APrEST81853) | |
Datasheet | PrEST Antigen DHRS11 (ATL-APrEST81853) Datasheet (External Link) |
Vendor Page | PrEST Antigen DHRS11 (ATL-APrEST81853) |