Protein Description: dishevelled associated activator of morphogenesis 2
Gene Name: DAAM2
Alternative Gene Name: KIAA0381
Sequence: NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Interspecies mouse/rat: ENSMUSG00000040260: 88%, ENSRNOG00000053945: 88%
Entrez Gene ID: 23500
Uniprot ID: Q86T65
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DAAM2
Alternative Gene Name: KIAA0381
Sequence: NISLLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRRQVREPS
Interspecies mouse/rat: ENSMUSG00000040260: 88%, ENSRNOG00000053945: 88%
Entrez Gene ID: 23500
Uniprot ID: Q86T65
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen DAAM2 (ATL-APrEST85570) | |
| Antibody | Anti DAAM2 pAb (ATL-HPA051300) |
| Documents & Links for PrEST Antigen DAAM2 (ATL-APrEST85570) | |
| Datasheet | PrEST Antigen DAAM2 (ATL-APrEST85570) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DAAM2 (ATL-APrEST85570) at Atlas |
| Documents & Links for PrEST Antigen DAAM2 (ATL-APrEST85570) | |
| Datasheet | PrEST Antigen DAAM2 (ATL-APrEST85570) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DAAM2 (ATL-APrEST85570) |