PrEST Antigen CUTA (ATL-APrEST95655)

Catalog No:
ATL-APrEST95655-100
$345.00

Description

Product Description

PrEST Antigen CUTA, Gene description: cutA divalent cation tolerance homolog, Alternative Gene Names: ACHAP, C6orf82, Antigen sequence: LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
Gene ID - Mouse ENSMUSG00000024194
Gene ID - Rat ENSRNOG00000000481
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen CUTA (ATL-APrEST95655)
Vendor Page PrEST Antigen CUTA (ATL-APrEST95655) at Atlas Antibodies

Documents & Links for PrEST Antigen CUTA (ATL-APrEST95655)
Vendor Page PrEST Antigen CUTA (ATL-APrEST95655)

Product Description

PrEST Antigen CUTA, Gene description: cutA divalent cation tolerance homolog, Alternative Gene Names: ACHAP, C6orf82, Antigen sequence: LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
Gene ID - Mouse ENSMUSG00000024194
Gene ID - Rat ENSRNOG00000000481
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen CUTA (ATL-APrEST95655)
Vendor Page PrEST Antigen CUTA (ATL-APrEST95655) at Atlas Antibodies

Documents & Links for PrEST Antigen CUTA (ATL-APrEST95655)
Vendor Page PrEST Antigen CUTA (ATL-APrEST95655)