Protein Description: CREB regulated transcription coactivator 1
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Sequence: PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Sequence: PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen CRTC1 (ATL-APrEST94869) | |
Antibody | Anti CRTC1 pAb (ATL-HPA063619) |
Documents & Links for PrEST Antigen CRTC1 (ATL-APrEST94869) | |
Datasheet | PrEST Antigen CRTC1 (ATL-APrEST94869) Datasheet (External Link) |
Vendor Page | PrEST Antigen CRTC1 (ATL-APrEST94869) at Atlas |
Documents & Links for PrEST Antigen CRTC1 (ATL-APrEST94869) | |
Datasheet | PrEST Antigen CRTC1 (ATL-APrEST94869) Datasheet (External Link) |
Vendor Page | PrEST Antigen CRTC1 (ATL-APrEST94869) |