Protein Description: collagen, type IV, alpha 6
Gene Name: COL4A6
Alternative Gene Name:
Sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: COL4A6
Alternative Gene Name:
Sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
Interspecies mouse/rat: ENSMUSG00000031273: 53%, ENSRNOG00000056772: 53%
Entrez Gene ID: 1288
Uniprot ID: Q14031
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen COL4A6 (ATL-APrEST92562) | |
Antibody | Anti COL4A6 pAb (ATL-HPA065393) |
Documents & Links for PrEST Antigen COL4A6 (ATL-APrEST92562) | |
Datasheet | PrEST Antigen COL4A6 (ATL-APrEST92562) Datasheet (External Link) |
Vendor Page | PrEST Antigen COL4A6 (ATL-APrEST92562) at Atlas |
Documents & Links for PrEST Antigen COL4A6 (ATL-APrEST92562) | |
Datasheet | PrEST Antigen COL4A6 (ATL-APrEST92562) Datasheet (External Link) |
Vendor Page | PrEST Antigen COL4A6 (ATL-APrEST92562) |