Protein Description: chemokine-like receptor 1
Gene Name: CMKLR1
Alternative Gene Name:
Sequence: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG
Interspecies mouse/rat: ENSMUSG00000042190: 80%, ENSRNOG00000000704: 82%
Entrez Gene ID: 1240
Uniprot ID: Q99788
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CMKLR1
Alternative Gene Name:
Sequence: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG
Interspecies mouse/rat: ENSMUSG00000042190: 80%, ENSRNOG00000000704: 82%
Entrez Gene ID: 1240
Uniprot ID: Q99788
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen CMKLR1 (ATL-APrEST84612) | |
| Antibody | Anti CMKLR1 pAb (ATL-HPA047865) |
| Documents & Links for PrEST Antigen CMKLR1 (ATL-APrEST84612) | |
| Datasheet | PrEST Antigen CMKLR1 (ATL-APrEST84612) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CMKLR1 (ATL-APrEST84612) at Atlas |
| Documents & Links for PrEST Antigen CMKLR1 (ATL-APrEST84612) | |
| Datasheet | PrEST Antigen CMKLR1 (ATL-APrEST84612) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CMKLR1 (ATL-APrEST84612) |