Protein Description: checkpoint with forkhead and ring finger domains
Gene Name: CHFR
Alternative Gene Name: FLJ10796, RNF196
Sequence: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
Interspecies mouse/rat: ENSMUSG00000014668: 97%, ENSRNOG00000037430: 96%
Entrez Gene ID: 55743
Uniprot ID: Q96EP1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CHFR
Alternative Gene Name: FLJ10796, RNF196
Sequence: AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR
Interspecies mouse/rat: ENSMUSG00000014668: 97%, ENSRNOG00000037430: 96%
Entrez Gene ID: 55743
Uniprot ID: Q96EP1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR |
Gene ID - Mouse | ENSMUSG00000014668 |
Gene ID - Rat | ENSRNOG00000037430 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen CHFR (ATL-APrEST94399) | |
Datasheet | PrEST Antigen CHFR (ATL-APrEST94399) Datasheet (External Link) |
Vendor Page | PrEST Antigen CHFR (ATL-APrEST94399) at Atlas |
Documents & Links for PrEST Antigen CHFR (ATL-APrEST94399) | |
Datasheet | PrEST Antigen CHFR (ATL-APrEST94399) Datasheet (External Link) |
Vendor Page | PrEST Antigen CHFR (ATL-APrEST94399) |