Protein Description: ceramide synthase 2
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Sequence: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Sequence: MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN |
Gene ID - Mouse | ENSMUSG00000015714 |
Gene ID - Rat | ENSRNOG00000021138 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen CERS2 (ATL-APrEST95520) | |
Datasheet | PrEST Antigen CERS2 (ATL-APrEST95520) Datasheet (External Link) |
Vendor Page | PrEST Antigen CERS2 (ATL-APrEST95520) at Atlas |
Documents & Links for PrEST Antigen CERS2 (ATL-APrEST95520) | |
Datasheet | PrEST Antigen CERS2 (ATL-APrEST95520) Datasheet (External Link) |
Vendor Page | PrEST Antigen CERS2 (ATL-APrEST95520) |