Protein Description: COBW domain containing 1
Gene Name: CBWD1
Alternative Gene Name:
Sequence: EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK
Interspecies mouse/rat: ENSMUSG00000024878: 97%, ENSRNOG00000015516: 97%
Entrez Gene ID: 55871
Uniprot ID: Q9BRT8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CBWD1
Alternative Gene Name:
Sequence: EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK
Interspecies mouse/rat: ENSMUSG00000024878: 97%, ENSRNOG00000015516: 97%
Entrez Gene ID: 55871
Uniprot ID: Q9BRT8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen CBWD1 (ATL-APrEST88989) | |
| Antibody | Anti CBWD1 pAb (ATL-HPA042813) |
| Documents & Links for PrEST Antigen CBWD1 (ATL-APrEST88989) | |
| Datasheet | PrEST Antigen CBWD1 (ATL-APrEST88989) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CBWD1 (ATL-APrEST88989) at Atlas |
| Documents & Links for PrEST Antigen CBWD1 (ATL-APrEST88989) | |
| Datasheet | PrEST Antigen CBWD1 (ATL-APrEST88989) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CBWD1 (ATL-APrEST88989) |