Protein Description: chromosome 18 open reading frame 25
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Sequence: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
Interspecies mouse/rat: ENSMUSG00000047466: 85%, ENSRNOG00000017215: 87%
Entrez Gene ID: 147339
Uniprot ID:
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Sequence: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
Interspecies mouse/rat: ENSMUSG00000047466: 85%, ENSRNOG00000017215: 87%
Entrez Gene ID: 147339
Uniprot ID:
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen C18orf25 (ATL-APrEST91341) | |
Antibody | Anti C18orf25 pAb (ATL-HPA065021) |
Documents & Links for PrEST Antigen C18orf25 (ATL-APrEST91341) | |
Datasheet | PrEST Antigen C18orf25 (ATL-APrEST91341) Datasheet (External Link) |
Vendor Page | PrEST Antigen C18orf25 (ATL-APrEST91341) at Atlas |
Documents & Links for PrEST Antigen C18orf25 (ATL-APrEST91341) | |
Datasheet | PrEST Antigen C18orf25 (ATL-APrEST91341) Datasheet (External Link) |
Vendor Page | PrEST Antigen C18orf25 (ATL-APrEST91341) |