Protein Description: BTB (POZ) domain containing 16
Gene Name: BTBD16
Alternative Gene Name: C10orf87, Em:AC061711.1, FLJ25359
Sequence: FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Interspecies mouse/rat: ENSMUSG00000040298: 74%, ENSRNOG00000036675: 74%
Entrez Gene ID: 118663
Uniprot ID: Q32M84
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: BTBD16
Alternative Gene Name: C10orf87, Em:AC061711.1, FLJ25359
Sequence: FLDRDIGRSLRPLFLCLRLHGITKGKDLEVLRHLNFFPESWLDQVTVNHYHALENGGDMVHLKDLNTQAVRFGLLFNQENTTYSKTIALYGFFFK
Interspecies mouse/rat: ENSMUSG00000040298: 74%, ENSRNOG00000036675: 74%
Entrez Gene ID: 118663
Uniprot ID: Q32M84
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen BTBD16 (ATL-APrEST80267) | |
| Antibody | Anti BTBD16 pAb (ATL-HPA040529) |
| Documents & Links for PrEST Antigen BTBD16 (ATL-APrEST80267) | |
| Datasheet | PrEST Antigen BTBD16 (ATL-APrEST80267) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTBD16 (ATL-APrEST80267) at Atlas |
| Documents & Links for PrEST Antigen BTBD16 (ATL-APrEST80267) | |
| Datasheet | PrEST Antigen BTBD16 (ATL-APrEST80267) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTBD16 (ATL-APrEST80267) |