Protein Description: ariadne RBR E3 ubiquitin protein ligase 2
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Sequence: DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV
Interspecies mouse/rat: ENSMUSG00000064145: 98%, ENSRNOG00000031827: 97%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Sequence: DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV
Interspecies mouse/rat: ENSMUSG00000064145: 98%, ENSRNOG00000031827: 97%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | DPGDIEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLV |
Gene ID - Mouse | ENSMUSG00000064145 |
Gene ID - Rat | ENSRNOG00000031827 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ARIH2 (ATL-APrEST92882) | |
Datasheet | PrEST Antigen ARIH2 (ATL-APrEST92882) Datasheet (External Link) |
Vendor Page | PrEST Antigen ARIH2 (ATL-APrEST92882) at Atlas Antibodies |
Documents & Links for PrEST Antigen ARIH2 (ATL-APrEST92882) | |
Datasheet | PrEST Antigen ARIH2 (ATL-APrEST92882) Datasheet (External Link) |
Vendor Page | PrEST Antigen ARIH2 (ATL-APrEST92882) |