Protein Description: alkB, alkylation repair homolog 8 (E. coli)
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Sequence: TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR
Interspecies mouse/rat: ENSMUSG00000025899: 78%, ENSRNOG00000024525: 74%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Sequence: TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR
Interspecies mouse/rat: ENSMUSG00000025899: 78%, ENSRNOG00000024525: 74%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ALKBH8 (ATL-APrEST87312) | |
Antibody | Anti ALKBH8 pAb (ATL-HPA038724) |
Documents & Links for PrEST Antigen ALKBH8 (ATL-APrEST87312) | |
Datasheet | PrEST Antigen ALKBH8 (ATL-APrEST87312) Datasheet (External Link) |
Vendor Page | PrEST Antigen ALKBH8 (ATL-APrEST87312) at Atlas |
Documents & Links for PrEST Antigen ALKBH8 (ATL-APrEST87312) | |
Datasheet | PrEST Antigen ALKBH8 (ATL-APrEST87312) Datasheet (External Link) |
Vendor Page | PrEST Antigen ALKBH8 (ATL-APrEST87312) |