PrEST Antigen AJM1 (ATL-APrEST95653)

Catalog No:
ATL-APrEST95653-100
$345.00

Description

Product Description

PrEST Antigen AJM1, Gene description: apical junction component 1 homolog, Alternative Gene Names: ajm-1, C9orf172, Antigen sequence: AFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence AFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDD
Gene ID - Mouse ENSMUSG00000029419
Gene ID - Rat ENSRNOG00000033863
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen AJM1 (ATL-APrEST95653)
Vendor Page PrEST Antigen AJM1 (ATL-APrEST95653) at Atlas Antibodies

Documents & Links for PrEST Antigen AJM1 (ATL-APrEST95653)
Vendor Page PrEST Antigen AJM1 (ATL-APrEST95653)

Product Description

PrEST Antigen AJM1, Gene description: apical junction component 1 homolog, Alternative Gene Names: ajm-1, C9orf172, Antigen sequence: AFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence AFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDD
Gene ID - Mouse ENSMUSG00000029419
Gene ID - Rat ENSRNOG00000033863
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen AJM1 (ATL-APrEST95653)
Vendor Page PrEST Antigen AJM1 (ATL-APrEST95653) at Atlas Antibodies

Documents & Links for PrEST Antigen AJM1 (ATL-APrEST95653)
Vendor Page PrEST Antigen AJM1 (ATL-APrEST95653)