Black abstract jellyfish shape

Biomolecules

Cosmo Bio USA provides a comprehensive, systematically selected portfolio of biomolecules from leading global suppliers, supporting advanced research across molecular biology, lipidomics, immunology, proteomics, and cell biology. Cosmo Bio Co., Ltd. distributes essential research reagents including DNA molecular weight markers, bacteriophage DNA, cDNA libraries, and glycosaminoglycans such as chondroitin and heparan sulfates—fundamental components for glycobiology and extracellular matrix investigations. Larodan offers an extensive collection of ultra-pure lipids, including fatty acids, sterols, glycerides, and phospholipids, utilized in lipidomics, metabolic profiling, and membrane biology studies. CUSABIO enhances the collection with a diverse catalog of validated recombinant proteins, peptides, and biochemicals, supporting multiple applications in oncology, immunology, infectious disease, and neuroscience. Atlas Antibodies facilitates assay development and antibody validation with their proprietary PrEST antigens, developed from the Human Protein Atlas.

MBL International supplies specialized biomolecules including cytokines, chemokines, and growth factors—essential tools for elucidating immune responses, inflammatory processes, and signaling pathways. Cellular Engineering Technologies (CET) complements the selection with yeast-expressed recombinant human proteins formulated for stem cell maintenance, differentiation, and regenerative medicine applications. These high-purity reagents exemplify Cosmo Bio USA's dedication to facilitating discovery by providing researchers with validated, application-specific tools. For investigations in cellular pathways, stem cell engineering, or lipid profile characterization, Cosmo Bio USA supplies the biomolecular reagents to support scientific advancement and experimental reproducibility across diverse fields of life science and biomedical research.

  • DDDDK-tag peptide

    MBL Life Sciences

    DDDDK-tag peptide

    Catalog No.(s): MBL-3325-205

    Product DescriptionThis synthetic peptide including DDDDK-tag sequence has been designed for the elution of DDDDK-tagged Protein Purification Gel. The peptide sequence is DYKDDDDK.Product Specifications Product...

    $313.00
    Choose Options
  • HA-tag peptide

    MBL Life Sciences

    HA-tag peptide

    Catalog No.(s): MBL-3320-205

    Product DescriptionThis synthetic peptide including HA-tag sequence has been designed for the elution of HA-tagged Protein Purification Gel. The peptide sequence is YPYDVPDYA.Product Specifications Product...

    $439.00
    Choose Options
  • V5-tag peptide

    MBL Life Sciences

    V5-tag peptide

    Catalog No.(s): MBL-3315-205

    Product DescriptionThis synthetic peptide including V5-tag sequence has been designed for the elution of V5-tagged Protein Purification Gel. The peptide sequence is GKPIPNPLLGLDST. A complete kit containing this peptide exists for the isolation of...

    $351.00
    Choose Options
  • His tag peptide

    MBL Life Sciences

    His tag peptide

    Catalog No.(s): MBL-3310-205

    Product DescriptionThis synthetic peptide including 6xHis tag sequence has been designed for the elution of His tagged Protein PURIFICATION KIT. The peptide sequence is XXX-(6xHis)-XXX.Product Specifications Product...

    $320.00
    Choose Options
  • c-Myc tag peptide (EQKLISEEDL)

    MBL Life Sciences

    c-Myc tag peptide (EQKLISEEDL)

    Catalog No.(s): MBL-3300-205

    Product Descriptionc-Myc tag peptide is a synthetic peptide with a molecular weight of 1,203 Da. The peptide sequence is EQKLISEEDL, corresponding to the C-terminal amino acids (410-419) of human c-myc protein. A complete kit containing this peptide...

    $351.00
    Choose Options
  • Hyaluronan Oligosaccharide 14mer sodium salt

    Cosmo Bio

    Hyaluronan Oligosaccharide 14mer sodium salt

    Catalog No.(s): CSR-11011

    Product DescriptionProduct SpecificationsDocuments & Links Documents & Links for Hyaluronan Oligosaccharide 14mer sodium salt Datasheet Hyaluronan Oligosaccharide 14mer sodium salt Datasheet Documents & Links for Hyaluronan Oligosaccharide...

    $261.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF226 (ATL-APrEST96237)

    Catalog No.(s): ATL-APrEST96237

    Product DescriptionPrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CENPJ (ATL-APrEST96236)

    Catalog No.(s): ATL-APrEST96236

    Product DescriptionPrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence:...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZDHHC15 (ATL-APrEST96235)

    Catalog No.(s): ATL-APrEST96235

    Product DescriptionPrEST Antigen ZDHHC15, Gene description: zinc finger DHHC-type palmitoyltransferase 15, Alternative Gene Names: DHHC15, FLJ31812, MRX91, Antigen sequence: NEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIK, Storage: Upon delivery store at -20°C...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF20 (ATL-APrEST96234)

    Catalog No.(s): ATL-APrEST96234

    Product DescriptionPrEST Antigen ZNF20, Gene description: zinc finger protein 20, Alternative Gene Names: KOX13, Antigen sequence: SYLDSFQSHDKACTKEKPYDGKECTET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ARSI (ATL-APrEST96233)

    Catalog No.(s): ATL-APrEST96233

    Product DescriptionPrEST Antigen ARSI, Gene description: arylsulfatase family member I, Alternative Gene Names: FLJ16069, SPG66, Antigen sequence: WAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRL, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen MCTP1 (ATL-APrEST96232)

    Catalog No.(s): ATL-APrEST96232

    Product DescriptionPrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CITED2 (ATL-APrEST96231)

    Catalog No.(s): ATL-APrEST96231

    Product DescriptionPrEST Antigen CITED2, Gene description: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2, Alternative Gene Names: MRG1, Antigen sequence: SGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMS, Storage: Upon delivery store...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen MRPL46 (ATL-APrEST96229)

    Catalog No.(s): ATL-APrEST96229

    Product DescriptionPrEST Antigen MRPL46, Gene description: mitochondrial ribosomal protein L46, Alternative Gene Names: C15orf4, LIECG2, P2ECSL, Antigen sequence: AAPSSNGSPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYSDHELRALDENQRLAKKKADLHDEEDEQDILL, Storage:...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TMPRSS11E (ATL-APrEST96228)

    Catalog No.(s): ATL-APrEST96228

    Product DescriptionPrEST Antigen TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Antigen sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV, Storage: Upon delivery...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen SERPINA4 (ATL-APrEST96226)

    Catalog No.(s): ATL-APrEST96226

    Product DescriptionPrEST Antigen SERPINA4, Gene description: serpin family A member 4, Alternative Gene Names: KAL, KLST, KST, PI4, Antigen sequence: HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TEX264 (ATL-APrEST96222)

    Catalog No.(s): ATL-APrEST96222

    Product DescriptionPrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CLDN20 (ATL-APrEST96220)

    Catalog No.(s): ATL-APrEST96220

    Product DescriptionPrEST Antigen CLDN20, Gene description: claudin 20, Antigen sequence: WYTKEIIANFLDLTVPESNKHEPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product Specifications Product Specifications Gene...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen NFIC (ATL-APrEST96219)

    Catalog No.(s): ATL-APrEST96219

    Product DescriptionPrEST Antigen NFIC, Gene description: nuclear factor I C, Alternative Gene Names: CTF, CTF5, NF-I, NFI, Antigen sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF208 (ATL-APrEST96218)

    Catalog No.(s): ATL-APrEST96218

    Product DescriptionPrEST Antigen ZNF208, Gene description: zinc finger protein 208, Alternative Gene Names: PMIDP, ZNF95, Antigen sequence: KVILRRYKIHHHACELGPIMNHHPTCGQMHI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen GPR157 (ATL-APrEST96217)

    Catalog No.(s): ATL-APrEST96217

    Product DescriptionPrEST Antigen GPR157, Gene description: G protein-coupled receptor 157, Alternative Gene Names: FLJ12132, Antigen sequence: VRKHINRAHTALSEYRPILSQEHRLLRHSSMADKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TFDP3 (ATL-APrEST96216)

    Catalog No.(s): ATL-APrEST96216

    Product DescriptionPrEST Antigen TFDP3, Gene description: transcription factor Dp family member 3, Alternative Gene Names: CT30, E2F-like, HCA661, Antigen sequence: STVNPLGKQLLPKTFGQSSVNIDQQVVIG, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CTNS (ATL-APrEST96215)

    Catalog No.(s): ATL-APrEST96215

    Product DescriptionPrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen H3-3B (ATL-APrEST96214)

    Catalog No.(s): ATL-APrEST96214

    Product DescriptionPrEST Antigen H3-3B, Gene description: H3.3 histone B, Alternative Gene Names: H3.3B, H3F3B, Antigen sequence: KPHRYRPGTVALREIRRYQKSTELLIR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen WDR46 (ATL-APrEST96212)

    Catalog No.(s): ATL-APrEST96212

    Product DescriptionPrEST Antigen WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Antigen sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV, Storage: Upon delivery store...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen APOOL (ATL-APrEST96210)

    Catalog No.(s): ATL-APrEST96210

    Product DescriptionPrEST Antigen APOOL, Gene description: apolipoprotein O like, Alternative Gene Names: AAIR8193, CXorf33, FAM121A, Mic27, MICOS27, UNQ8193, Antigen sequence:...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CCKBR (ATL-APrEST96209)

    Catalog No.(s): ATL-APrEST96209

    Product DescriptionPrEST Antigen CCKBR, Gene description: cholecystokinin B receptor, Antigen sequence: FMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen VSX1 (ATL-APrEST96208)

    Catalog No.(s): ATL-APrEST96208

    Product DescriptionPrEST Antigen VSX1, Gene description: visual system homeobox 1, Alternative Gene Names: PPCD, PPCD1, PPD, Antigen sequence: RQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRTKRR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen C20orf173 (ATL-APrEST96207)

    Catalog No.(s): ATL-APrEST96207

    Product DescriptionPrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen SLITRK5 (ATL-APrEST96206)

    Catalog No.(s): ATL-APrEST96206

    Product DescriptionPrEST Antigen SLITRK5, Gene description: SLIT and NTRK like family member 5, Alternative Gene Names: bA364G4.2, KIAA0918, LRRC11, Antigen sequence: RESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQYLHP,...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen AP1M2 (ATL-APrEST96203)

    Catalog No.(s): ATL-APrEST96203

    Product DescriptionPrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen DPYS (ATL-APrEST96202)

    Catalog No.(s): ATL-APrEST96202

    Product DescriptionPrEST Antigen DPYS, Gene description: dihydropyrimidinase, Alternative Gene Names: DHPase, Antigen sequence: THYWKKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNNCQKAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen COMMD2 (ATL-APrEST96201)

    Catalog No.(s): ATL-APrEST96201

    Product DescriptionPrEST Antigen COMMD2, Gene description: COMM domain containing 2, Alternative Gene Names: HSPC042, Antigen sequence: ELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSV, Storage: Upon delivery store at...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen USP26 (ATL-APrEST96200)

    Catalog No.(s): ATL-APrEST96200

    Product DescriptionPrEST Antigen USP26, Gene description: ubiquitin specific peptidase 26, Antigen sequence: VPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CCDC134 (ATL-APrEST96199)

    Catalog No.(s): ATL-APrEST96199

    Product DescriptionPrEST Antigen CCDC134, Gene description: coiled-coil domain containing 134, Alternative Gene Names: FLJ22349, Antigen sequence: GISEKDSNFQNPFKIDRTEFIPSTDPFQKALRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles...

    $345.00
    Choose Options