Anti ZZZ3 pAb (ATL-HPA066197)

Catalog No:
ATL-HPA066197-25
$303.00

Description

Product Description

Protein Description: zinc finger, ZZ-type containing 3
Gene Name: ZZZ3
Alternative Gene Name: ATAC1, DKFZP564I052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039068: 91%, ENSRNOG00000050321: 90%
Entrez Gene ID: 26009
Uniprot ID: Q8IYH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY
Gene Sequence LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY
Gene ID - Mouse ENSMUSG00000039068
Gene ID - Rat ENSRNOG00000050321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197)
Datasheet Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA066197) at Atlas Antibodies

Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197)
Datasheet Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA066197)

Product Description

Protein Description: zinc finger, ZZ-type containing 3
Gene Name: ZZZ3
Alternative Gene Name: ATAC1, DKFZP564I052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039068: 91%, ENSRNOG00000050321: 90%
Entrez Gene ID: 26009
Uniprot ID: Q8IYH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY
Gene Sequence LTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMNTAVEDASDDESIPIMY
Gene ID - Mouse ENSMUSG00000039068
Gene ID - Rat ENSRNOG00000050321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197)
Datasheet Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA066197) at Atlas Antibodies

Documents & Links for Anti ZZZ3 pAb (ATL-HPA066197)
Datasheet Anti ZZZ3 pAb (ATL-HPA066197) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA066197)