Anti ZSWIM3 pAb (ATL-HPA055692)

Catalog No:
ATL-HPA055692-25
$447.00

Description

Product Description

Protein Description: zinc finger, SWIM-type containing 3
Gene Name: ZSWIM3
Alternative Gene Name: C20orf164, dJ337O18.7, PPP1R174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045822: 82%, ENSRNOG00000015525: 86%
Entrez Gene ID: 140831
Uniprot ID: Q96MP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG
Gene Sequence SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG
Gene ID - Mouse ENSMUSG00000045822
Gene ID - Rat ENSRNOG00000015525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692)
Datasheet Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link)
Vendor Page Anti ZSWIM3 pAb (ATL-HPA055692) at Atlas Antibodies

Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692)
Datasheet Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link)
Vendor Page Anti ZSWIM3 pAb (ATL-HPA055692)

Product Description

Protein Description: zinc finger, SWIM-type containing 3
Gene Name: ZSWIM3
Alternative Gene Name: C20orf164, dJ337O18.7, PPP1R174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045822: 82%, ENSRNOG00000015525: 86%
Entrez Gene ID: 140831
Uniprot ID: Q96MP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG
Gene Sequence SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG
Gene ID - Mouse ENSMUSG00000045822
Gene ID - Rat ENSRNOG00000015525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692)
Datasheet Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link)
Vendor Page Anti ZSWIM3 pAb (ATL-HPA055692) at Atlas Antibodies

Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692)
Datasheet Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link)
Vendor Page Anti ZSWIM3 pAb (ATL-HPA055692)