Description
Product Description
Protein Description: zinc finger, SWIM-type containing 3
Gene Name: ZSWIM3
Alternative Gene Name: C20orf164, dJ337O18.7, PPP1R174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045822: 82%, ENSRNOG00000015525: 86%
Entrez Gene ID: 140831
Uniprot ID: Q96MP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZSWIM3
Alternative Gene Name: C20orf164, dJ337O18.7, PPP1R174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045822: 82%, ENSRNOG00000015525: 86%
Entrez Gene ID: 140831
Uniprot ID: Q96MP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG |
Gene Sequence | SCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIHGDSKVASPG |
Gene ID - Mouse | ENSMUSG00000045822 |
Gene ID - Rat | ENSRNOG00000015525 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692) | |
Datasheet | Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link) |
Vendor Page | Anti ZSWIM3 pAb (ATL-HPA055692) at Atlas Antibodies |
Documents & Links for Anti ZSWIM3 pAb (ATL-HPA055692) | |
Datasheet | Anti ZSWIM3 pAb (ATL-HPA055692) Datasheet (External Link) |
Vendor Page | Anti ZSWIM3 pAb (ATL-HPA055692) |