Description
Product Description
Protein Description: zinc finger and SCAN domain containing 25
Gene Name: ZSCAN25
Alternative Gene Name: FLJ32468, ZNF498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070420: 79%, ENSRNOG00000042213: 76%
Entrez Gene ID: 221785
Uniprot ID: Q6NSZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZSCAN25
Alternative Gene Name: FLJ32468, ZNF498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070420: 79%, ENSRNOG00000042213: 76%
Entrez Gene ID: 221785
Uniprot ID: Q6NSZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKE |
Gene Sequence | PAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKE |
Gene ID - Mouse | ENSMUSG00000070420 |
Gene ID - Rat | ENSRNOG00000042213 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZSCAN25 pAb (ATL-HPA057173) | |
Datasheet | Anti ZSCAN25 pAb (ATL-HPA057173) Datasheet (External Link) |
Vendor Page | Anti ZSCAN25 pAb (ATL-HPA057173) at Atlas Antibodies |
Documents & Links for Anti ZSCAN25 pAb (ATL-HPA057173) | |
Datasheet | Anti ZSCAN25 pAb (ATL-HPA057173) Datasheet (External Link) |
Vendor Page | Anti ZSCAN25 pAb (ATL-HPA057173) |