Anti ZSCAN10 pAb (ATL-HPA076826)

Catalog No:
ATL-HPA076826-25
$303.00
Protein Description: zinc finger and SCAN domain containing 10
Gene Name: ZSCAN10
Alternative Gene Name: ZNF206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023902: 67%, ENSRNOG00000021782: 61%
Entrez Gene ID: 84891
Uniprot ID: Q96SZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
Gene ID - Mouse ENSMUSG00000023902
Gene ID - Rat ENSMUSG00000023902
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZSCAN10 pAb (ATL-HPA076826)
Datasheet Anti ZSCAN10 pAb (ATL-HPA076826) Datasheet (External Link)
Vendor Page Anti ZSCAN10 pAb (ATL-HPA076826) at Atlas

Documents & Links for Anti ZSCAN10 pAb (ATL-HPA076826)
Datasheet Anti ZSCAN10 pAb (ATL-HPA076826) Datasheet (External Link)
Vendor Page Anti ZSCAN10 pAb (ATL-HPA076826)