Description
Product Description
Protein Description: zinc finger, RAN-binding domain containing 2
Gene Name: ZRANB2
Alternative Gene Name: ZIS, ZIS1, ZIS2, ZNF265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028180: 100%, ENSRNOG00000009990: 100%
Entrez Gene ID: 9406
Uniprot ID: O95218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZRANB2
Alternative Gene Name: ZIS, ZIS1, ZIS2, ZNF265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028180: 100%, ENSRNOG00000009990: 100%
Entrez Gene ID: 9406
Uniprot ID: O95218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS |
Gene Sequence | TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS |
Gene ID - Mouse | ENSMUSG00000028180 |
Gene ID - Rat | ENSRNOG00000009990 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZRANB2 pAb (ATL-HPA063298) | |
Datasheet | Anti ZRANB2 pAb (ATL-HPA063298) Datasheet (External Link) |
Vendor Page | Anti ZRANB2 pAb (ATL-HPA063298) at Atlas Antibodies |
Documents & Links for Anti ZRANB2 pAb (ATL-HPA063298) | |
Datasheet | Anti ZRANB2 pAb (ATL-HPA063298) Datasheet (External Link) |
Vendor Page | Anti ZRANB2 pAb (ATL-HPA063298) |