Anti ZNRF2 pAb (ATL-HPA072244)

Catalog No:
ATL-HPA072244-25
$447.00

Description

Product Description

Protein Description: zinc and ring finger 2
Gene Name: ZNRF2
Alternative Gene Name: RNF202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058446: 84%, ENSRNOG00000049057: 86%
Entrez Gene ID: 223082
Uniprot ID: Q8NHG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK
Gene Sequence NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK
Gene ID - Mouse ENSMUSG00000058446
Gene ID - Rat ENSRNOG00000049057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244)
Datasheet Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link)
Vendor Page Anti ZNRF2 pAb (ATL-HPA072244) at Atlas Antibodies

Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244)
Datasheet Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link)
Vendor Page Anti ZNRF2 pAb (ATL-HPA072244)

Product Description

Protein Description: zinc and ring finger 2
Gene Name: ZNRF2
Alternative Gene Name: RNF202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058446: 84%, ENSRNOG00000049057: 86%
Entrez Gene ID: 223082
Uniprot ID: Q8NHG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK
Gene Sequence NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK
Gene ID - Mouse ENSMUSG00000058446
Gene ID - Rat ENSRNOG00000049057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244)
Datasheet Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link)
Vendor Page Anti ZNRF2 pAb (ATL-HPA072244) at Atlas Antibodies

Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244)
Datasheet Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link)
Vendor Page Anti ZNRF2 pAb (ATL-HPA072244)