Protein Description: zinc and ring finger 2
Gene Name: ZNRF2
Alternative Gene Name: RNF202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058446: 84%, ENSRNOG00000049057: 86%
Entrez Gene ID: 223082
Uniprot ID: Q8NHG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNRF2
Alternative Gene Name: RNF202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058446: 84%, ENSRNOG00000049057: 86%
Entrez Gene ID: 223082
Uniprot ID: Q8NHG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK |
| Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244) | |
| Datasheet | Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link) |
| Vendor Page | Anti ZNRF2 pAb (ATL-HPA072244) at Atlas |
| Documents & Links for Anti ZNRF2 pAb (ATL-HPA072244) | |
| Datasheet | Anti ZNRF2 pAb (ATL-HPA072244) Datasheet (External Link) |
| Vendor Page | Anti ZNRF2 pAb (ATL-HPA072244) |