Anti ZNHIT3 pAb (ATL-HPA060019)

Atlas Antibodies

Catalog No: ATL-HPA060019-25

• 

Product Description

Protein Description: zinc finger, HIT-type containing 3
Gene Name: ZNHIT3
Alternative Gene Name: TRIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020526: 92%, ENSRNOG00000027818: 83%
Entrez Gene ID: 9326
Uniprot ID: Q15649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQ
• Gene Sequence: SDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQ
• Gene ID - Mouse: ENSMUSG00000020526
• Gene ID - Rat: ENSRNOG00000027818
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.