Anti ZNF879 pAb (ATL-HPA068608)

Atlas Antibodies

Catalog No: ATL-HPA068608-25

• 
• 

Product Description

Protein Description: zinc finger protein 879
Gene Name: ZNF879
Alternative Gene Name: DKFZp686E2433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044296: 53%, ENSRNOG00000030517: 49%
Entrez Gene ID: 345462
Uniprot ID: B4DU55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKTYINEDKLEKQQGKKNRLFSKVLVTIK
• Gene Sequence: LEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKTYINEDKLEKQQGKKNRLFSKVLVTIK
• Gene ID - Mouse: ENSMUSG00000044296
• Gene ID - Rat: ENSRNOG00000030517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.