Protein Description: zinc finger protein 879
Gene Name: ZNF879
Alternative Gene Name: DKFZp686E2433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044296: 53%, ENSRNOG00000030517: 49%
Entrez Gene ID: 345462
Uniprot ID: B4DU55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF879
Alternative Gene Name: DKFZp686E2433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044296: 53%, ENSRNOG00000030517: 49%
Entrez Gene ID: 345462
Uniprot ID: B4DU55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEQGEDPWMVESGVPQGAHLGWESLFGTIVSKEENQEVMKKLIIDGTFDFKLEKTYINEDKLEKQQGKKNRLFSKVLVTIK |
| Documents & Links for Anti ZNF879 pAb (ATL-HPA068608) | |
| Datasheet | Anti ZNF879 pAb (ATL-HPA068608) Datasheet (External Link) |
| Vendor Page | Anti ZNF879 pAb (ATL-HPA068608) at Atlas |
| Documents & Links for Anti ZNF879 pAb (ATL-HPA068608) | |
| Datasheet | Anti ZNF879 pAb (ATL-HPA068608) Datasheet (External Link) |
| Vendor Page | Anti ZNF879 pAb (ATL-HPA068608) |