Protein Description: zinc finger protein 865
Gene Name: ZNF865
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074405: 97%, ENSRNOG00000028628: 97%
Entrez Gene ID: 100507290
Uniprot ID: P0CJ78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF865
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074405: 97%, ENSRNOG00000028628: 97%
Entrez Gene ID: 100507290
Uniprot ID: P0CJ78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLAHKAENL |
Documents & Links for Anti ZNF865 pAb (ATL-HPA068079) | |
Datasheet | Anti ZNF865 pAb (ATL-HPA068079) Datasheet (External Link) |
Vendor Page | Anti ZNF865 pAb (ATL-HPA068079) at Atlas |
Documents & Links for Anti ZNF865 pAb (ATL-HPA068079) | |
Datasheet | Anti ZNF865 pAb (ATL-HPA068079) Datasheet (External Link) |
Vendor Page | Anti ZNF865 pAb (ATL-HPA068079) |