Protein Description: zinc finger protein 829
Gene Name: ZNF829
Alternative Gene Name: DKFZp779O175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 44%, ENSRNOG00000020774: 47%
Entrez Gene ID: 374899
Uniprot ID: Q3KNS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF829
Alternative Gene Name: DKFZp779O175
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099689: 44%, ENSRNOG00000020774: 47%
Entrez Gene ID: 374899
Uniprot ID: Q3KNS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSLKKRHFSQVIITREDMSTFIQPTFLIPPQKTMSEEKPWECK |
| Documents & Links for Anti ZNF829 pAb (ATL-HPA073073) | |
| Datasheet | Anti ZNF829 pAb (ATL-HPA073073) Datasheet (External Link) |
| Vendor Page | Anti ZNF829 pAb (ATL-HPA073073) at Atlas |
| Documents & Links for Anti ZNF829 pAb (ATL-HPA073073) | |
| Datasheet | Anti ZNF829 pAb (ATL-HPA073073) Datasheet (External Link) |
| Vendor Page | Anti ZNF829 pAb (ATL-HPA073073) |