Anti ZNF781 pAb (ATL-HPA062512)

Atlas Antibodies

Catalog No: ATL-HPA062512-25

• 
• 

Product Description

Protein Description: zinc finger protein 781
Gene Name: ZNF781
Alternative Gene Name: FLJ37549
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058291: 38%, ENSRNOG00000053366: 41%
Entrez Gene ID: 163115
Uniprot ID: Q8N8C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQIC
• Gene Sequence: QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQIC
• Gene ID - Mouse: ENSMUSG00000058291
• Gene ID - Rat: ENSRNOG00000053366
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.