Anti ZNF778 pAb (ATL-HPA057151)

Atlas Antibodies

Catalog No: ATL-HPA057151-25

• 

Product Description

Protein Description: zinc finger protein 778
Gene Name: ZNF778
Alternative Gene Name: FLJ31875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063108: 45%, ENSRNOG00000025937: 45%
Entrez Gene ID: 197320
Uniprot ID: Q96MU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGPALRQDRSWFRASNETQTARSHNGGQLCDRTQCGEA
• Gene Sequence: KGPALRQDRSWFRASNETQTARSHNGGQLCDRTQCGEA
• Gene ID - Mouse: ENSMUSG00000063108
• Gene ID - Rat: ENSRNOG00000025937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.