Anti ZNF776 pAb (ATL-HPA068553)

Atlas Antibodies

Catalog No: ATL-HPA068553-25

• 

Product Description

Protein Description: zinc finger protein 776
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 27%, ENSRNOG00000015271: 28%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGE
• Gene Sequence: KQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGE
• Gene ID - Mouse: ENSMUSG00000050064
• Gene ID - Rat: ENSRNOG00000015271
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.