Protein Description: zinc finger protein 776
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 27%, ENSRNOG00000015271: 28%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF776
Alternative Gene Name: FLJ38288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 27%, ENSRNOG00000015271: 28%
Entrez Gene ID: 284309
Uniprot ID: Q68DI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGDILHQGTQHNQKLNGFGAYEKKLDDDANHHQDQKQHIGE |
| Documents & Links for Anti ZNF776 pAb (ATL-HPA068553) | |
| Datasheet | Anti ZNF776 pAb (ATL-HPA068553) Datasheet (External Link) |
| Vendor Page | Anti ZNF776 pAb (ATL-HPA068553) at Atlas |
| Documents & Links for Anti ZNF776 pAb (ATL-HPA068553) | |
| Datasheet | Anti ZNF776 pAb (ATL-HPA068553) Datasheet (External Link) |
| Vendor Page | Anti ZNF776 pAb (ATL-HPA068553) |