Anti ZNF771 pAb (ATL-HPA059398)

Atlas Antibodies

Catalog No: ATL-HPA059398-25

• 

Product Description

Protein Description: zinc finger protein 771
Gene Name: ZNF771
Alternative Gene Name: DSC43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054716: 92%, ENSRNOG00000043225: 90%
Entrez Gene ID: 51333
Uniprot ID: Q7L3S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP
• Gene Sequence: EEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVP
• Gene ID - Mouse: ENSMUSG00000054716
• Gene ID - Rat: ENSRNOG00000043225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.